Recombinant Human MEFV Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15553

Gene Name: MEFV

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Thr101

End Site: Ala220

Coverage: 0.17

Isoelectric Point: 10.5

Core Sequence: TDDSAASSSLGENKPRSLKTPDHPEGNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQGKPRTRSPALPGGRSPGPCRALEGGQAEVRLRRNASSAGRLQGLAGGA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Cynomolgus monkey - 78%

Alternative gene names: MEF; TRIM20

Alternative protein names: Pyrin; Marenostrin

Protein name: MEFV innate immunity regulator, pyrin

Full length: 781 amino acids

Entry name: MEFV_HUMAN

• Artikelnummer: ASBPP-4290-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4290-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4210