Note: Dry Ice fees will be extra-charged
Uniprot: Q86YT6
Gene Name: MIB1
Expression System: Escherichia coli
Molecular Weight: 10.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 100%
Start Site: Lys421
End Site: Val490
Coverage: 0.08
Isoelectric Point: 6
Core Sequence: KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 40%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: DIP1; KIAA1323; ZZANK2
Alternative protein names: E3 ubiquitin-protein ligase MIB1; DAPK-interacting protein 1; DIP-1; Mind bomb homolog 1; RING-type E3 ubiquitin transferase MIB1; Zinc finger ZZ type with ankyrin repeat domain protein 2
Protein name: MIB E3 ubiquitin protein ligase 1
Full length: 1006 amino acids
Entry name: MIB1_HUMAN
Product panel: E3 Ligase,Enzyme