Note: Dry Ice fees will be extra-charged
Uniprot: P08473
Gene Name: MME
Expression System: Escherichia coli
Molecular Weight: 45 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: N-SUMO & C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Glu471
End Site: Trp750
Coverage: 0.38
Isoelectric Point: 6.5
Core Sequence: EKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 99%
Alternative gene names: EPN
Alternative protein names: Neprilysin; Atriopeptidase; Common acute lymphocytic leukemia antigen; CALLA; Enkephalinase; Neutral endopeptidase 24.11; NEP; Neutral endopeptidase; Skin fibroblast elastase; SFE; CD antigen CD10
Protein name: membrane metalloendopeptidase
Full length: 750 amino acids
Entry name: NEP_HUMAN
CD Antigen: CD10
Product panel: IHC Pathology,CD Antigen,Enzyme
Deutsch
English
