Recombinant Human MS4A18 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q3C1V0

Gene Name: MS4A18

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val11

End Site: Asn150

Coverage: 0.38

Isoelectric Point: 7

Core Sequence: VPGIIAPDNVHVIQPSNPVASGNHLQPSEVTTYPISPKVIHCDTGRANLQNLLVVNQNSAAGVQSQPIGYQRQYPVGTASLQTVPGVIQYTQGTTNLQTWPGDLQNPLNANPGLTHTSNSSQWNTSFASFTSFNPKKFIN

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Membrane-spanning 4-domains subfamily A member 18

Protein name: membrane spanning 4-domains A18

Full length: 400 amino acids

Entry name: M4A18_HUMAN

• Artikelnummer: ASBPP-4076-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4076-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 728588