Recombinant Human MTHFS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P49914

Gene Name: MTHFS

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Met1

End Site: Ala203

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 85%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: 5-formyltetrahydrofolate cyclo-ligase; 5; 10-methenyl-tetrahydrofolate synthetase; MTHFS; Methenyl-THF synthetase

Protein name: methenyltetrahydrofolate synthetase

Full length: 203 amino acids

Entry name: MTHFS_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3874-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3874-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10588