Recombinant Human MTPN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P58546

Gene Name: MTPN

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Gln118

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Myotrophin; Protein V-1

Protein name: myotrophin

Full length: 118 amino acids

Entry name: MTPN_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3880-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3880-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 136319