Recombinant Human MYBPC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q00872

Gene Name: MYBPC1

Expression System: Escherichia coli

Molecular Weight: 40 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Glu11

End Site: Pro340

Coverage: 0.29

Isoelectric Point: 7

Core Sequence: EVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 50%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: MYBPCS

Alternative protein names: Myosin-binding protein C; slow-type; Slow MyBP-C; C-protein; skeletal muscle slow isoform

Protein name: myosin binding protein C1

Full length: 1141 amino acids

Entry name: MYPC1_HUMAN

• Artikelnummer: ASBPP-4235-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4235-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 4604