Recombinant Human MYG1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HB07

Gene Name: MYG1

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Tyr71

End Site: Glu280

Coverage: 0.65

Isoelectric Point: 5.5

Core Sequence: YRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: C12orf10

Alternative protein names: MYG1 exonuclease

Protein name: MYG1 exonuclease

Full length: 376 amino acids

Entry name: MYG1_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3722-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3722-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 60314