Recombinant Human MYOZ3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDC0

Gene Name: MYOZ3

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Met11

End Site: Pro200

Coverage: 0.80

Isoelectric Point: 9.5

Core Sequence: MAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Pig - 76%, Cynomolgus monkey - 97%

Alternative gene names: FRP3

Alternative protein names: Myozenin-3; Calsarcin-3; FATZ-related protein 3

Protein name: myozenin 3

Full length: 251 amino acids

Entry name: MYOZ3_HUMAN

• Artikelnummer: ASBPP-4253-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4253-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 91977