Recombinant Human NBAS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A2RRP1

Gene Name: NBAS

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu541

End Site: Asn670

Coverage: 0.05

Isoelectric Point: 5.5

Core Sequence: EALSLAHTYGLDTDLVYQRQWRKSAVNVASIQNYLSKIKKRSWVLHECLERVPENVDAAKELLQYGLKGTDLEALLAIGKGADDGRFTLPGEIDIDSISYEELSPPDEEPAKNKKEKELKKRQELLKLVN

Homologies: Highest protein sequence identity to the following orthologs: Pig - 94%, Cynomolgus monkey - 97%

Alternative gene names: NAG

Alternative protein names: NBAS subunit of NRZ tethering complex; Neuroblastoma-amplified gene protein; Neuroblastoma-amplified sequence

Protein name: NBAS subunit of NRZ tethering complex

Full length: 2371 amino acids

Entry name: NBAS_HUMAN

• Artikelnummer: ASBPP-4316-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4316-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51594