Recombinant Human NEIL2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q969S2

Gene Name: NEIL2

Expression System: Escherichia coli

Molecular Weight: 38 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Met1

End Site: Ser332

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Pig - 73%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Endonuclease 8-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; Endonuclease VIII-like 2; Nei homolog 2; NEH2; Nei-like protein 2

Protein name: nei like DNA glycosylase 2

Full length: 332 amino acids

Entry name: NEIL2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-4028-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4028-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 252969