Recombinant Human NEMP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O14524

Gene Name: NEMP1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Lys331

End Site: Asn440

Coverage: 0.28

Isoelectric Point: 4.5

Core Sequence: KGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 51%, Pig - 88%

Alternative gene names: KIAA0286; TMEM194; TMEM194A

Alternative protein names: Nuclear envelope integral membrane protein 1

Protein name: nuclear envelope integral membrane protein 1

Full length: 444 amino acids

Entry name: NEMP1_HUMAN

• Artikelnummer: ASBPP-3738-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3738-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 23306