Recombinant Human NF1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P21359

Gene Name: NF1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Val2511

End Site: Leu2610

Coverage: 0.03

Isoelectric Point: 10

Core Sequence: VGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Neurofibromin; Neurofibromatosis-related protein NF-1) [Cleaved into: Neurofibromin truncated]

Protein name: neurofibromin 1

Full length: 2839 amino acids

Entry name: NF1_HUMAN

• Artikelnummer: ASBPP-4393-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4393-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 4763