Recombinant Human Thyroid Transcription Factor 1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P43699

Gene Name: NKX2-1

Expression System: Escherichia coli

Molecular Weight: 52.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys151

End Site: Gln230

Coverage: 0.22

Isoelectric Point: 8

Core Sequence: KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: NKX2A; TITF1; TTF1

Alternative protein names: Homeobox protein Nkx-2.1; Homeobox protein NK-2 homolog A; Thyroid nuclear factor 1; Thyroid transcription factor 1; TTF-1; Thyroid-specific enhancer-binding protein; T/EBP

Protein name: NK2 homeobox 1

Full length: 371 amino acids

Entry name: NKX21_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-4081-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4081-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7080