Recombinant Human Thyroid Transcription Factor 1 Protein

Recombinant Human Thyroid Transcription Factor 1 Protein
Artikelnummer
ASBPP-4080-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P43699

Gene Name: NKX2-1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys151

End Site: Gln230

Coverage: 0.22

Isoelectric Point: 11.5

Core Sequence: KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: NKX2A; TITF1; TTF1

Alternative protein names: Homeobox protein Nkx-2.1; Homeobox protein NK-2 homolog A; Thyroid nuclear factor 1; Thyroid transcription factor 1; TTF-1; Thyroid-specific enhancer-binding protein; T/EBP

Protein name: NK2 homeobox 1

Full length: 371 amino acids

Entry name: NKX21_HUMAN

Product panel: DNA binding & Chromatin
Mehr Informationen
Artikelnummer ASBPP-4080-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4080-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 7080
Produktinformation (PDF)
×
MSDS (PDF)
×