Recombinant Human NLRP6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P59044

Gene Name: NLRP6

Expression System: Escherichia coli

Molecular Weight: 64.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Thr11

End Site: Glu190

Coverage: 0.21

Isoelectric Point: 7

Core Sequence: TGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 71%, Pig - 78%, Cynomolgus monkey - 93%

Alternative gene names: NALP6; PYPAF5

Alternative protein names: NACHT; LRR and PYD domains-containing protein 6; Angiotensin II/vasopressin receptor; PYRIN-containing APAF1-like protein 5

Protein name: NLR family pyrin domain containing 6

Full length: 892 amino acids

Entry name: NLRP6_HUMAN

• Artikelnummer: ASBPP-4268-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4268-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 171389