Recombinant Human NOBOX Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60393

Gene Name: NOBOX

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Pro71

End Site: Gly310

Coverage: 0.36

Isoelectric Point: 9

Core Sequence: PQHDPLEIPEQSLKLIPLVSGKRELTRGQKAGEKPLAAGPGEEELLRGSAPHAQDTQSEELPPSCTISGEKKPPAVSGEATGADAGRLCPPPRSRAPHKDRTLARSRPQTQGEDCSLPVGEVKIGKRSYSPAPGKQKKPNAMGLAPTSSPGAPNSARATHNPVPCGSGRGPCHLANLLSTLAQSNQNRDHKQGPPEVTCQIRKKTRTLYRSDQLEELEKIFQEDHYPDSDKRREIAQTVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 43%, Pig - 63%

Alternative gene names: /

Alternative protein names: Homeobox protein NOBOX

Protein name: NOBOX oogenesis homeobox

Full length: 691 amino acids

Entry name: NOBOX_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3739-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3739-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 135935