Recombinant Human OLR1 Protein

Recombinant Human OLR1 Protein
Artikelnummer
ASBPP-351-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P78380

Gene Name: OLR1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Ser61

End Site: Trp150

Coverage: 0.34

Isoelectric Point: 6.5

Core Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 66%, Pig - 67%, Cynomolgus monkey - 92%

Alternative gene names: CLEC8A; LOX1

Alternative protein names: Oxidized low-density lipoprotein receptor 1; Ox-LDL receptor 1; C-type lectin domain family 8 member A; Lectin-like oxidized LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; hLOX-1; Lectin-type oxidized LDL receptor 1) [Cleaved into: Oxidized low-density lipoprotein receptor 1; soluble form]

Protein name: oxidized low density lipoprotein receptor 1

Full length: 273 amino acids

Entry name: OLR1_HUMAN
Mehr Informationen
Artikelnummer ASBPP-351-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-351-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 4973
Produktinformation (PDF)
×
MSDS (PDF)
×