Recombinant Human ORM2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P19652

Gene Name: ORM2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Arg101

End Site: Glu200

Coverage: 0.55

Isoelectric Point: 4.5

Core Sequence: RENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Rat - 42%, Pig - 56%

Alternative gene names: AGP2

Alternative protein names: Alpha-1-acid glycoprotein 2; AGP 2; Orosomucoid-2; OMD 2

Protein name: orosomucoid 2

Full length: 201 amino acids

Entry name: A1AG2_HUMAN

• Artikelnummer: ASBPP-3781-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3781-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5005