Recombinant Human PAK1IP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NWT1

Gene Name: PAK1IP1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Phe241

End Site: Lys350

Coverage: 0.30

Isoelectric Point: 9.5

Core Sequence: FKAHENRVKDMFSFEIPEHHVIVSASSDGFIKMWKLKQDKKVPPSLLCEINTNARLTCLGVWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 75%

Alternative gene names: PIP1; WDR84

Alternative protein names: p21-activated protein kinase-interacting protein 1; PAK/PLC-interacting protein 1; hPIP1; PAK1-interacting protein 1; WD repeat-containing protein 84

Protein name: PAK1 interacting protein 1

Full length: 392 amino acids

Entry name: PK1IP_HUMAN

• Artikelnummer: ASBPP-3017-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3017-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 55003