Recombinant Human PBX4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYU1

Gene Name: PBX4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu241

End Site: Ser310

Coverage: 0.21

Isoelectric Point: 8.5

Core Sequence: EAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVGVPGNHASCLSTPSSGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 82%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Pre-B-cell leukemia transcription factor 4; Homeobox protein PBX4

Protein name: PBX homeobox 4

Full length: 374 amino acids

Entry name: PBX4_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3241-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3241-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80714