Recombinant Human PDIA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13087

Gene Name: PDIA2

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Gln371

End Site: Gly520

Coverage: 0.31

Isoelectric Point: 5

Core Sequence: QVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 63%, Pig - 88%, Cynomolgus monkey - 93%

Alternative gene names: PDIP

Alternative protein names: Protein disulfide-isomerase A2; Pancreas-specific protein disulfide isomerase; PDIp

Protein name: protein disulfide isomerase family A member 2

Full length: 525 amino acids

Entry name: PDIA2_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-4230-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4230-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 64714