Recombinant Human PDIA5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14554

Gene Name: PDIA5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu31

End Site: Ala150

Coverage: 0.24

Isoelectric Point: 9

Core Sequence: ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: PDIR

Alternative protein names: Protein disulfide-isomerase A5; Protein disulfide isomerase-related protein

Protein name: protein disulfide isomerase family A member 5

Full length: 519 amino acids

Entry name: PDIA5_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-4302-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4302-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10954