Recombinant Human PDILT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N807

Gene Name: PDILT

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Pro461

End Site: Glu560

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: PFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 68%, Cynomolgus monkey - 90%

Alternative gene names: /

Alternative protein names: Protein disulfide-isomerase-like protein of the testis

Protein name: protein disulfide isomerase like, testis expressed

Full length: 584 amino acids

Entry name: PDILT_HUMAN

• Artikelnummer: ASBPP-3219-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3219-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 204474