Recombinant Human PGF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P49763

Gene Name: PGF

Expression System: Escherichia coli

Molecular Weight: 65 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Leu19

End Site: Arg221

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 68%, Pig - 89%

Alternative gene names: PGFL; PLGF

Alternative protein names: Placenta growth factor; PlGF

Protein name: placental growth factor

Full length: 221 amino acids

Entry name: PLGF_HUMAN

• Artikelnummer: ASBPP-3004-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3004-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5228