Recombinant Human PHF13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86YI8

Gene Name: PHF13

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser91

End Site: Gly170

Coverage: 0.30

Isoelectric Point: 10

Core Sequence: SHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: PHD finger protein 13; Survival time-associated PHD finger protein in ovarian cancer 1; SPOC1

Protein name: PHD finger protein 13

Full length: 300 amino acids

Entry name: PHF13_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3815-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3815-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 148479