Recombinant Human PITPNB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P48739

Gene Name: PITPNB

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Val271

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%

Alternative gene names: /

Alternative protein names: Phosphatidylinositol transfer protein beta isoform; PI-TP-beta; PtdIns transfer protein beta; PtdInsTP beta

Protein name: phosphatidylinositol transfer protein beta

Full length: 271 amino acids

Entry name: PIPNB_HUMAN

• Artikelnummer: ASBPP-3950-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3950-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 23760