Recombinant Human PLRG1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43660

Gene Name: PLRG1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Thr21

End Site: Trp190

Coverage: 0.34

Isoelectric Point: 10

Core Sequence: THDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 86%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Pleiotropic regulator 1

Protein name: pleiotropic regulator 1

Full length: 514 amino acids

Entry name: PLRG1_HUMAN

• Artikelnummer: ASBPP-10487-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10487-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 5356