Recombinant Human POLR1D Protein

Recombinant Human POLR1D Protein
Artikelnummer
ASBPP-3303-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P0DPB6

Gene Name: POLR1D

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ile11

End Site: Glu130

Coverage: 0.99

Isoelectric Point: 6.5

Core Sequence: ISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 95%

Alternative gene names: /

Alternative protein names: DNA-directed RNA polymerases I and III subunit RPAC2; RNA polymerases I and III subunit AC2; AC19; DNA-directed RNA polymerase I subunit D; RNA polymerase I 16 kDa subunit; RPA16; RPC16; hRPA19

Protein name: DNA-directed RNA polymerases I and III subunit RPAC2 (RNA polymerases I and III subunit AC2) (AC19) (DNA-directed RNA polymerase I subunit D) (RNA polymerase I 16 kDa subunit) (RPA16) (RPC16) (hRPA19)

Full length: 133 amino acids

Entry name: RPAC2_HUMAN

Product panel: DNA binding & Chromatin
Mehr Informationen
Artikelnummer ASBPP-3303-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3303-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×