Recombinant Human PPIC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P45877

Gene Name: PPIC

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys31

End Site: Ala210

Coverage: 0.89

Isoelectric Point: 8

Core Sequence: KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 72%, Pig - 95%, Cynomolgus monkey - 97%

Alternative gene names: CYPC

Alternative protein names: Peptidyl-prolyl cis-trans isomerase C; PPIase C; Cyclophilin C; Rotamase C

Protein name: peptidylprolyl isomerase C

Full length: 212 amino acids

Entry name: PPIC_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3873-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3873-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5480