Recombinant Human PRKCQ Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q04759

Gene Name: PRKCQ

Expression System: Escherichia coli

Molecular Weight: 57.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Gly581

End Site: Gly700

Coverage: 0.17

Isoelectric Point: 5.5

Core Sequence: GQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: PRKCT

Alternative protein names: Protein kinase C theta type; nPKC-theta

Protein name: protein kinase C theta

Full length: 706 amino acids

Entry name: KPCT_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3224-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3224-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5588