Recombinant Human PRX Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BXM0

Gene Name: PRX

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Leu1221

End Site: Ala1460

Coverage: 0.16

Isoelectric Point: 6.5

Core Sequence: LELDVGLSREAQAGEAATGEGGLRLKLPTLGARARVGGEGAEEQPPGAERTFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHKLKVRLPRFGLVRAKEGAEEGEKAKSPKLRLPRVGFSQSEMVTGEGSPSPEEEEEEEEEGSGEGASGRRGRVRVRLPRVGLAAPSKASRGQEGDAAPKSPVREKSPKFRFPRVSLSPKARSGSGDQEEGGLRVRLPSVGFSETGAPGPARMEGAQAAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 72%, Pig - 85%, Cynomolgus monkey - 93%

Alternative gene names: KIAA1620

Alternative protein names: Periaxin

Protein name: periaxin

Full length: 1461 amino acids

Entry name: PRAX_HUMAN

• Artikelnummer: ASBPP-4232-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4232-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57716