Recombinant Human PTGFRN Protein

Recombinant Human PTGFRN Protein
Artikelnummer
ASBPP-4311-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2B2

Gene Name: PTGFRN

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Val551

End Site: Trp660

Coverage: 0.14

Isoelectric Point: 7

Core Sequence: VVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPNETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: CD9P1; EWIF; FPRP; KIAA1436

Alternative protein names: Prostaglandin F2 receptor negative regulator; CD9 partner 1; CD9P-1; Glu-Trp-Ile EWI motif-containing protein F; EWI-F; Prostaglandin F2-alpha receptor regulatory protein; Prostaglandin F2-alpha receptor-associated protein; CD antigen CD315

Protein name: prostaglandin F2 receptor inhibitor

Full length: 879 amino acids

Entry name: FPRP_HUMAN

CD Antigen: CD315

Product panel: CD Antigen
Mehr Informationen
Artikelnummer ASBPP-4311-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4311-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 5738
Produktinformation (PDF)
×
MSDS (PDF)
×