Recombinant Human PTPN4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P29074

Gene Name: PTPN4

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Phe321

End Site: Ile510

Coverage: 0.21

Isoelectric Point: 9.5

Core Sequence: FAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSKPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHYSHSQQDLESHINETFDIPSSPEKPTPNGGI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Tyrosine-protein phosphatase non-receptor type 4; Protein-tyrosine phosphatase MEG1; MEG; PTPase-MEG1

Protein name: protein tyrosine phosphatase non-receptor type 4

Full length: 926 amino acids

Entry name: PTN4_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-4406-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4406-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 5775