Recombinant Human PTPRJ Protein

Recombinant Human PTPRJ Protein
Artikelnummer
ASBPP-408-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q12913

Gene Name: PTPRJ

Expression System: Escherichia coli

Molecular Weight: 52 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Lys1001

End Site: Gly1330

Coverage: 0.26

Isoelectric Point: 7

Core Sequence: KDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 47%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: DEP1

Alternative protein names: Receptor-type tyrosine-protein phosphatase eta; Protein-tyrosine phosphatase eta; R-PTP-eta; Density-enhanced phosphatase 1; DEP-1; HPTP eta; Protein-tyrosine phosphatase receptor type J; R-PTP-J; CD antigen CD148

Protein name: protein tyrosine phosphatase receptor type J

Full length: 1337 amino acids

Entry name: PTPRJ_HUMAN

CD Antigen: CD148

Product panel: CD Antigen,Enzyme
Mehr Informationen
Artikelnummer ASBPP-408-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-408-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 5795
Produktinformation (PDF)
×
MSDS (PDF)
×