Recombinant Human PYGO1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3Y4

Gene Name: PYGO1

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Tyr161

End Site: Ile370

Coverage: 0.52

Isoelectric Point: 7

Core Sequence: YNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNNAVNQENSRSSSTEATNNNPANGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKWFHRI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Pygopus homolog 1

Protein name: pygopus family PHD finger 1

Full length: 419 amino acids

Entry name: PYGO1_HUMAN

• Artikelnummer: ASBPP-10458-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10458-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26108