Note: Dry Ice fees will be extra-charged
Uniprot: P04049
Gene Name: RAF1
Expression System: Escherichia coli
Molecular Weight: 16.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Ser211
End Site: Tyr340
Coverage: 0.21
Isoelectric Point: 10.5
Core Sequence: SLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSY
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: RAF
Alternative protein names: RAF proto-oncogene serine/threonine-protein kinase; Proto-oncogene c-RAF; cRaf; Raf-1
Protein name: Raf-1 proto-oncogene, serine/threonine kinase
Full length: 648 amino acids
Entry name: RAF1_HUMAN
Product panel: Enzyme