Recombinant Human RAG2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55895

Gene Name: RAG2

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Ala211

End Site: Glu410

Coverage: 0.40

Isoelectric Point: 4

Core Sequence: AKNDTIYILGGHSLANNIRPANLYRIRVDLPLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQTTFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: V(D)J recombination-activating protein 2; RAG-2

Protein name: recombination activating 2

Full length: 527 amino acids

Entry name: RAG2_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-4284-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4284-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 5897