Recombinant Human RALGAPB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86X10

Gene Name: RALGAPB

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Pro361

End Site: Val440

Coverage: 0.06

Isoelectric Point: 12.5

Core Sequence: PPTPVNRLSMPQSAAVSTTPPHNRRHRAVTVNKATMKTSTVSTAHASKVQHQTSSTSPLSSPNQTSSEPRPLPAPRRPKV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%

Alternative gene names: KIAA1219

Alternative protein names: Ral GTPase-activating protein subunit beta; p170

Protein name: Ral GTPase activating protein non-catalytic subunit beta

Full length: 1494 amino acids

Entry name: RLGPB_HUMAN

• Artikelnummer: ASBPP-7205-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-7205-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 57148