Recombinant Human RGS10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43665

Gene Name: RGS10

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Arg11

End Site: Thr170

Coverage: 0.95

Isoelectric Point: 6

Core Sequence: RKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 93%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Regulator of G-protein signaling 10; RGS10

Protein name: regulator of G protein signaling 10

Full length: 181 amino acids

Entry name: RGS10_HUMAN

• Artikelnummer: ASBPP-3914-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3914-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6001