Recombinant Human RMDN1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96DB5

Gene Name: RMDN1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ile71

End Site: Ser160

Coverage: 0.30

Isoelectric Point: 5

Core Sequence: ISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 92%

Alternative gene names: FAM82B

Alternative protein names: Regulator of microtubule dynamics protein 1; RMD-1; hRMD-1; Protein FAM82B

Protein name: regulator of microtubule dynamics 1

Full length: 314 amino acids

Entry name: RMD1_HUMAN

• Artikelnummer: ASBPP-3979-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3979-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51115