Recombinant Human RNF38 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0F5

Gene Name: RNF38

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Thr41

End Site: Gln190

Coverage: 0.29

Isoelectric Point: 8

Core Sequence: TTVQEDAHFKAFFQSEDSPSPKRQRLSHSVFDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: E3 ubiquitin-protein ligase RNF38; RING finger protein 38; RING-type E3 ubiquitin transferase RNF38

Protein name: ring finger protein 38

Full length: 515 amino acids

Entry name: RNF38_HUMAN

Product panel: E3 Ligase,Enzyme

• Artikelnummer: ASBPP-10492-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10492-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 152006