Recombinant Human RSL24D1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHA3

Gene Name: RSL24D1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Phe71

End Site: Glu160

Coverage: 0.58

Isoelectric Point: 10

Core Sequence: FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDME

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: C15orf15; RPL24L

Alternative protein names: Probable ribosome biogenesis protein RLP24; Ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like

Protein name: ribosomal L24 domain containing 1

Full length: 163 amino acids

Entry name: RLP24_HUMAN

• Artikelnummer: ASBPP-10461-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10461-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51187