Recombinant Human RuvB Like 1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y265

Gene Name: RUVBL1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Tyr131

End Site: Phe300

Coverage: 0.39

Isoelectric Point: 5.5

Core Sequence: YEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: INO80H; NMP238; TIP49; TIP49A

Alternative protein names: RuvB-like 1; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; ECP-54; INO80 complex subunit H; Nuclear matrix protein 238; NMP 238; Pontin 52; TIP49a; TIP60-associated protein 54-alpha; TAP54-alpha

Protein name: RuvB like AAA ATPase 1

Full length: 456 amino acids

Entry name: RUVB1_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-440-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-440-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 8607