Recombinant Human RYR2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92736

Gene Name: RYR2

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asp3961

End Site: Thr4240

Coverage: 0.05

Isoelectric Point: 4.5

Core Sequence: DSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Ryanodine receptor 2; RYR-2; RyR2; hRYR-2; Cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; Type 2 ryanodine receptor

Protein name: ryanodine receptor 2

Full length: 4967 amino acids

Entry name: RYR2_HUMAN

• Artikelnummer: ASBPP-4196-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4196-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6262