Recombinant Human SCIN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6U3

Gene Name: SCIN

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Asp531

End Site: Trp710

Coverage: 0.26

Isoelectric Point: 4.5

Core Sequence: DANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 59%, Pig - 94%, Cynomolgus monkey - 97%

Alternative gene names: KIAA1905

Alternative protein names: Scinderin; Adseverin

Protein name: scinderin

Full length: 715 amino acids

Entry name: SCIN_HUMAN

• Artikelnummer: ASBPP-1045-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-1045-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 85477