Recombinant Human SETBP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6X0

Gene Name: SETBP1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Pro1091

End Site: Thr1260

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: PPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSASLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLVSEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0437

Alternative protein names: SET-binding protein; SEB

Protein name: SET binding protein 1

Full length: 1596 amino acids

Entry name: SETBP_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-1046-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-1046-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26040