Recombinant Human SF3A2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15428

Gene Name: SF3A2

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys91

End Site: Phe210

Coverage: 0.27

Isoelectric Point: 10

Core Sequence: KEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: SAP62

Alternative protein names: Splicing factor 3A subunit 2; SF3a66; Spliceosome-associated protein 62; SAP 62

Protein name: splicing factor 3a subunit 2

Full length: 464 amino acids

Entry name: SF3A2_HUMAN

• Artikelnummer: ASBPP-10391-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10391-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 8175