Recombinant Human SH3RF2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TEC5

Gene Name: SH3RF2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Asn631

End Site: Gln700

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: NSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 87%

Alternative gene names: POSH3; POSHER; PPP1R39; RNF158

Alternative protein names: E3 ubiquitin-protein ligase SH3RF2; Heart protein phosphatase 1-binding protein; HEPP1; POSH-eliminating RING protein; Protein phosphatase 1 regulatory subunit 39; RING finger protein 158; RING-type E3 ubiquitin transferase SH3RF2; SH3 domain-containing RING finger protein 2

Protein name: SH3 domain containing ring finger 2

Full length: 729 amino acids

Entry name: SH3R2_HUMAN

Product panel: E3 Ligase,Enzyme

• Artikelnummer: ASBPP-3315-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3315-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 153769