Recombinant Human SKP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P63208

Gene Name: SKP1

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Lys163

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%

Alternative gene names: EMC19; OCP2; SKP1A; TCEB1L

Alternative protein names: S-phase kinase-associated protein 1; Cyclin-A/CDK2-associated protein p19; p19A; Organ of Corti protein 2; OCP-2; Organ of Corti protein II; OCP-II; RNA polymerase II elongation factor-like protein; SIII; Transcription elongation factor B polypeptide 1-like; p19skp1

Protein name: S-phase kinase associated protein 1

Full length: 163 amino acids

Entry name: SKP1_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3960-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3960-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6500